быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-MouseCD262/TRAILR2 mAb (A24376)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-MouseCD262/TRAILR2 mAb Catalog No. A24376 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62153-ABflo594 Background
Predicted to enable TRAIL receptor activity; identical protein binding activity; and protease binding activity. Predicted to be involved in TRAIL-activated apoptotic signaling pathway and positive regulation of apoptotic process. Predicted to act upstream of or within apoptotic process and regulation of apoptotic process. Predicted to be located in Golgi apparatus; cytosol; and membrane raft. Predicted to be active in cell surface and plasma membrane. Is expressed in bladder; liver; renal vasculature; urethra of female; and urethra of male. Human ortholog(s) of this gene implicated in carcinoma (multiple); cervical cancer; hematologic cancer (multiple); and urinary bladder cancer. Orthologous to several human genes including TNFRSF10A (TNF receptor superfamily member 10a).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 53-170 of mouse CD262/TRAILR2( NP_064671.2). Sequence NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCV Gene ID Swiss Prot Synonyms MK; DR5; Ly98; KILLER; TRICKB; TRAILR2; TRICK2A; TRICK2B Calculated MW 42kDa Observed MW Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Membrane, Single-pass type I membrane protein 
Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Mouse CD262/TRAILR2 mAb(A24376, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD262/TRAILR2 mAb(A24376, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 53-170 of mouse CD262/TRAILR2( NP_064671.2). Isotype IgG







