- 100 T
- 200 T
- 500 T
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Mouse CD47 mAb Catalog No. A24377 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62629-ABflo488 Background
Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion and thrombospondin receptor activity. Involved in regulation of nitric oxide biosynthetic process. Acts upstream of or within several processes, including monocyte aggregation; opsonization; and positive regulation of phagocytosis. Located in extracellular exosome. Is integral component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD47 (CD47 molecule).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of mouse CD47 (NP_034711.1). Sequence QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNT Gene ID Swiss Prot Synonyms IAP; Itgp; 9130415E20Rik; B430305P08Rik Calculated MW 33KDa/35KDa Observed MW Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane 
Flow cytometry: 1X10^6 C57 BL/6 mouse Splenocytes were surface-stained with ABflo® 488 Rabbit anti-Mouse CD47 mAb (A24377, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained C57 BL/6 mouse Splenocytes were used as blank control (red line).

Flow cytometry: 1X10^6 Hep G2 cells (negative control) were surface-stained with ABflo® 488 Rabbit anti-Mouse CD47 mAb (A24377, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained Hep G2 cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57 BL/6 mouse Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD47 mAb (A24377, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of mouse CD47 (NP_034711.1). Isotype IgG







