быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human Flt3/CD135 mAb (A24381)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human Flt3/CD135 mAb Catalog No. A24381 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC63039-ABflo647 Background
This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-163 of human Flt3/CD135 (NP_004110.2). Sequence NQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNT Gene ID Swiss Prot Synonyms FLT3; CD135; FLK-2; FLK2; STK1; fms related tyrosine kinase 3 Calculated MW 108kDa/112kDa Observed MW Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Endoplasmic reticulum lumen, Membrane, Single-pass type I membrane protein 
Flow cytometry:1X10^6 HEL cells (negative control, Left) and REH cells(Right) were surface-stained with ABflo® 647 Rabbit anti-Human Flt3/CD135 mAb(A24381, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 REH cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Flt3/CD135(A24381, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-163 of human Flt3/CD135 (NP_004110.2). Isotype IgG







