быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human Podoplanin mAb (A24409)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human Podoplanin mAb Catalog No. A24409 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC63004-ABflo647 Background
This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-123 of Human Podoplanin(NM_006474.5). Sequence EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK Gene ID Swiss Prot Synonyms PDPN; AGGRUS; GP36; GP40; Gp38; HT1A-1; OTS8; PA2.26; T1A; T1A-2; T1A2; TI1A; podoplanin Calculated MW 12kDa/16kDa/18kDa/24kDa Observed MW Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell projection, Membrane, Single-pass type I membrane protein, filopodium membrane, lamellipodium membrane, microvillus membrane, ruffle membrane 
Flow cytometry:1X10^6 knockout (KO) 293T cells (negative control, Left) and 293T (right) cells were surface-stained with ABflo® 647 Rabbit anti-Human Podoplanin mAb(A24409, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293T cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Podoplanin mAb(A24409, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-123 of Human Podoplanin(NM_006474.5). Isotype IgG







