- 100 T
- 200 T
- 500 T
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human KIR2DL2/KIR2DL3 mAb Catalog No. A24575 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62218-ABflo647 Background
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several 'framework' genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3(NP_056952.2). Sequence HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH Gene ID Swiss Prot Synonyms KIR2DL3; CD158B2; CD158b; GL183; KIR-023GB; KIR-K7b; KIR-K7c; KIR2DS5; KIRCL23; NKAT; NKAT2; NKAT2A; NKAT2B; p58; killer cell immunoglobulin-like receptor 2DL3 Calculated MW 27kDa/37kDa/38kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Single-pass type I membrane protein 
Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human KIR2DL2/KIR2DL3 mAb(A24575, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human KIR2DL2/KIR2DL3 mAb(A24575, 5 μl/Test, right).

Flow cytometry:1X10^6 CHO cells (negative control, left) and CHO(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human KIR2DL2/KIR2DL3 mAb(A24575, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 CHO(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human KIR2DL2/KIR2DL3 mAb(A24575, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3(NP_056952.2). Isotype IgG







