быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Vinculin Rabbit mAb (A2752)
- Описание
- Характеристики
-
Overview
Product name Vinculin Rabbit mAb Catalog No. A2752 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51900 Background
Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1). Sequence DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM Gene ID Swiss Prot Synonyms MV; MVCL; CMD1W; CMH15; HEL114 Calculated MW 124kDa Observed MW 124kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:10000 - 1:300000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples HeLa, HepG2, RD, Mouse liver, Mouse brain, Rat liver, Rat skeletal muscle, Rat brain Cellular location Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, adherens junction, cytoskeleton, focal adhesion Customer validation WB(Homo sapiens, Oryctolagus cuniculus, Anatinae, Mus musculus, Rattus norvegicus)
Western blot analysis of various lysates, using Vinculin antibody (A2752) at 1:250000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Confocal imaging of HeLa cells using Vinculin Rabbit mAb (A2752, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1). Isotype IgG