быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
4-1BBL/CD137L Rabbit mAb (A3386)
- Описание
- Характеристики
-
Overview
Product name 4-1BBL/CD137L Rabbit mAb Catalog No. A3386 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1963 Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 155-254 of human 4-1BBL/CD137L (P41273). Sequence GEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE Gene ID Swiss Prot Synonyms CD137L; TNLG5A; 4-1BB-L Calculated MW 27kDa Observed MW 27kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Raji, SH-SY5Y, Mouse lung, Mouse brain, Rat lung Cellular location Membrane, Single-pass type II membrane protein 
Western blot analysis of extracts of various cell lines, using 4-1BBL/CD137L Rabbit mAb (A3386) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 155-254 of human 4-1BBL/CD137L (P41273). Isotype IgG







