быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TRIB3 Rabbit mAb (A3523)
- Описание
- Характеристики
-
Overview
Product name TRIB3 Rabbit mAb Catalog No. A3523 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2685 Background
The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRIB3(Q96RU7) Sequence MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGG Gene ID Swiss Prot Synonyms NIPK; SINK; TRB3; SKIP3; C20orf97 Calculated MW 40kDa Observed MW 43kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562 Cellular location Nucleus 
Western blot analysis of extracts of K-562 cells, using TRIB3 antibody (A3523) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRIB3(Q96RU7) Isotype IgG