быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
YB-1/YBX1 Rabbit mAb (A3534)
- Описание
- Характеристики
-
Overview
Product name YB-1/YBX1 Rabbit mAb Catalog No. A3534 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0797 Background
This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB-1/YBX1 (P67809). Sequence GAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE Gene ID Swiss Prot Synonyms YB1; BP-8; CSDB; DBPB; YB-1; CBF-A; CSDA2; EFI-A; NSEP1; NSEP-1; MDR-NF1 Calculated MW 36kDa Observed MW 49kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP ChIP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- ChIP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse testis, Rat heart, HeLa Cellular location Cytoplasm, Cytoplasmic granule, Nucleus, Secreted 
Western blot analysis of extracts of HeLa cells, using YB-1/YBX1 Rabbit mAb (A3534) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using YB-1/YBX1 Rabbit mAb (A3534) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry of paraffin-embedded human colon using YB-1/YBX1 Rabbit mAb (A3534) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human thyroid cancer using YB-1/YBX1 Rabbit mAb (A3534) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse kidney using YB-1/YBX1 Rabbit mAb (A3534) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat colon using YB-1/YBX1 Rabbit mAb (A3534) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat kidney using YB-1/YBX1 Rabbit mAb (A3534) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using YB-1/YBX1 Rabbit mAb (A3534) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using YB-1/YBX1 Rabbit mAb (A3534) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using YB-1/YBX1 Rabbit mAb (A3534) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using YB-1/YBX1 antibody (A3534) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB-1/YBX1 (P67809). Isotype IgG