быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Tryptophanyl-tRNA synthetase 1 Rabbit mAb (A4469)
- Описание
- Характеристики
-
Overview
Product name Tryptophanyl-tRNA synthetase 1 Rabbit mAb Catalog No. A4469 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1018 Background
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 3-98 of human Tryptophanyl-tRNA synthetase 1 (P23381). Sequence NSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGI Gene ID Swiss Prot Synonyms HMN9; WARS; IFI53; IFP53; GAMMA-2 Calculated MW 53kDa Observed MW 53kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Mouse testis, Mouse brain, Rat brain Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using Tryptophanyl-tRNA synthetase 1 Rabbit mAb (A4469) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 3-98 of human Tryptophanyl-tRNA synthetase 1 (P23381). Isotype IgG