быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Aconitase 1 (ACO1) Rabbit mAb (A4821)
- Описание
- Характеристики
-
Overview
Product name Aconitase 1 (ACO1) Rabbit mAb Catalog No. A4821 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2731 Background
The protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variantsImmunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aconitase 1 (ACO1) (P21399). Sequence MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAM Gene ID Swiss Prot Synonyms IRP1; ACONS; HEL60; IREB1; IREBP; IREBP1 Calculated MW 98kDa Observed MW 98kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse liver, Mouse kidney, Rat kidney Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using Aconitase 1 (ACO1) antibody (A4821) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of U2OS cells using Aconitase 1 (ACO1) antibody (A4821) at dilution of 1:150. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using Aconitase 1 (ACO1) antibody (A4821) at dilution of 1:150. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using Aconitase 1 (ACO1) antibody (A4821) at dilution of 1:150. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aconitase 1 (ACO1) (P21399). Isotype IgG