быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TSC1 Rabbit mAb (A5121)
- Описание
- Характеристики
-
Overview
Product name TSC1 Rabbit mAb Catalog No. A5121 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1236 Background
This gene is a tumor suppressor gene that encodes the growth inhibitory protein hamartin. The encoded protein interacts with and stabilizes the GTPase activating protein tuberin. This hamartin-tuberin complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. This protein also functions as a co-chaperone for Hsp90 that inhibits its ATPase activity. This protein functions as a facilitator of Hsp90-mediated folding of kinase and non-kinase clients, including TSC2 and thereby preventing their ubiquitination and proteasomal degradation. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1065-1164 of human Hamartin (Q92574). Sequence TTMGEASASIPTTVGSLPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELGKDLGVEAKIPLNLDGPHPSPPTPDSVGQLHIMDYNETHHEHS Gene ID Swiss Prot Synonyms LAM; TSC Calculated MW 130kDa Observed MW 150kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-1080 Cellular location Cytoplasm, Membrane, Peripheral membrane protein 
Western blot analysis of extracts of HT-1080 cells, using TSC1 Rabbit mAb (A5121) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1065-1164 of human Hamartin (Q92574). Isotype IgG







