быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
WIF1 Rabbit mAb (A5171)
- Описание
- Характеристики
-
Overview
Product name WIF1 Rabbit mAb Catalog No. A5171 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1161 Background
The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 280-379 of human WIF1 (Q9Y5W5). Sequence QPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW Gene ID Swiss Prot Synonyms WIF-1 Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse lung, Mouse stomach, Rat lung, Rat stomach Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using WIF1 Rabbit mAb (A5171) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 280-379 of human WIF1 (Q9Y5W5). Isotype IgG