быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
WAPL Rabbit mAb (A5923)
- Описание
- Характеристики
-
Overview
Product name WAPL Rabbit mAb Catalog No. A5923 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2088 Background
Involved in several processes, including negative regulation of DNA replication; negative regulation of chromatin binding activity; and regulation of sister chromatid cohesion. Located in several cellular components, including Golgi apparatus; intercellular bridge; and microtubule cytoskeleton.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WAPL (Q7Z5K2). Sequence MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPKKPKVEEESTGDPFGFDSDDESLPVSSKNLAQVKCSSYSES Gene ID Swiss Prot Synonyms FOE; WAPAL; KIAA0261 Calculated MW 133kDa Observed MW 150kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, RD, Jurkat, C2C12 Cellular location cytoplasm, cytosol, intercellular bridge, mitotic spindle, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using WAPL Rabbit mAb (A5923) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of C2C12 cells, using WAPL Rabbit mAb (A5923) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of HeLa cells using WAPL Rabbit mAb (A5923) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using WAPL Rabbit mAb (A5923) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WAPL (Q7Z5K2). Isotype IgG