быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TWEAKR/Fn14/CD266 Rabbit mAb (A5955)
- Описание
- Характеристики
-
Overview
Product name TWEAKR/Fn14/CD266 Rabbit mAb Catalog No. A5955 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2119 Background
Involved in positive regulation of extrinsic apoptotic signaling pathway and regulation of wound healing. Predicted to be located in cell surface and ruffle. Predicted to be active in plasma membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-129 of human TWEAKR/Fn14/CD266 (Q9NP84). Sequence MDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ Gene ID Swiss Prot Synonyms FN14; CD266; TWEAKR Calculated MW 14kDa Observed MW 17kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HepG2, PC-3 Cellular location Plasma membrane Customer validation (Hela HepG2 PC-3 ES-2 EFE-184 PEO)
IHC，IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using TWEAKR/Fn14/CD266 Rabbit mAb (A5955) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of NIH-3T3 cells using TWEAKR/Fn14/CD266 Rabbit mAb (A5955) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-129 of human TWEAKR/Fn14/CD266 (Q9NP84). Isotype IgG