быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Tropomyosin 1 Rabbit mAb (A8723)
- Описание
- Характеристики
-
Overview
Product name Tropomyosin 1 Rabbit mAb Catalog No. A8723 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1283 Background
This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy and dilated cardiomyopathy 1Y.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493). Sequence LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI Gene ID Swiss Prot Synonyms CMH3; TMSA; CMD1Y; LVNC9; C15orf13; HEL-S-265; HTM-alpha Calculated MW 33kDa Observed MW 32、35、36、41kDa Applications
Reactivity Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart Cellular location Cytoplasm, cytoskeleton 
Western blot analysis of extracts of various cell lines, using Tropomyosin 1 Rabbit mAb (A8723) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded rat heart using Tropomyosin 1 Rabbit mAb (A8723) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using Tropomyosin 1 Rabbit mAb (A8723) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat heart using Tropomyosin 1 Rabbit mAb (A8723) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse heart using Tropomyosin 1 Rabbit mAb (A8723) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of Rat heart using 3 μg Tropomyosin 1 Rabbit mAb (A8723). Western blot was performed from the immunoprecipitate using Tropomyosin 1 Rabbit mAb (A8723) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493). Isotype IgG