быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
UBA1 Rabbit mAb (A9254)
- Описание
- Характеристики
-
Overview
Product name UBA1 Rabbit mAb Catalog No. A9254 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1493 Background
The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 959-1058 of human UBA1 (P22314). Sequence EVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR Gene ID Swiss Prot Synonyms A1S9; A1ST; GXP1; UBE1; A1S9T; AMCX1; POC20; SMAX2; UBA1A; UBE1X; VEXAS; CFAP124 Calculated MW 118kDa Observed MW 110-118kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, K-562, Mouse testis, Mouse brain, Mouse spleen, Rat brain Cellular location Cytoplasm, Mitochondrion, Nucleus 
Western blot analysis of extracts of various cell lines, using UBA1 Rabbit mAb (A9254) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human esophageal using UBA1 Rabbit mAb (A9254) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of U-2 OS cells using UBA1 Rabbit mAb (A9254) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 959-1058 of human UBA1 (P22314). Isotype IgG