быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
VPS35 Rabbit mAb (A9278)
- Описание
- Характеристики
-
Overview
Product name VPS35 Rabbit mAb Catalog No. A9278 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1509 Background
This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human VPS35 (Q96QK1). Sequence YAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQ Gene ID Swiss Prot Synonyms MEM3; PARK17 Calculated MW 92kDa Observed MW 92kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, Jurkat, SH-SY5Y, Mouse liver, Mouse brain, Mouse kidney, Rat brain Cellular location Cytoplasm, Early endosome, Endosome, Late endosome, Membrane, Peripheral membrane protein 
Western blot analysis of extracts of various cell lines, using VPS35 Rabbit mAb (A9278) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human VPS35 (Q96QK1). Isotype IgG