быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
WSTF Rabbit mAb (A9519)
- Описание
- Характеристики
-
Overview
Product name WSTF Rabbit mAb Catalog No. A9519 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1614 Background
This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WSTF (Q9UIG0). Sequence MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLE Gene ID Swiss Prot Synonyms WSTF; WBSCR9; WBSCR10 Calculated MW 171kDa Observed MW 185kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, PC-12, SH-SY5Y, SKOV3, Mouse brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using WSTF Rabbit mAb (A9519) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WSTF (Q9UIG0). Isotype IgG