![[KD Validated] ISG15 Rabbit mAb (A2416)](/upload/resize_cache/iblock/e36/340_340_140cd750bba9870f18aada2478b24840a/50bytdgn8fcqylod7aqh7o9aq20maspz.jpg "[KD Validated] ISG15 Rabbit mAb (A2416)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
[KD Validated] ISG15 Rabbit mAb (A2416)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] ISG15 Rabbit mAb Catalog No. A2416 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53794 Background
The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1). Sequence MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS Gene ID Swiss Prot Synonyms G1P2; IP17; UCRP; IFI15; IMD38; hUCRP Calculated MW 18kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse spleen, Rat lung, 293T Cellular location Cytoplasm, Secreted Customer validation WB(Mus musculus, Homo sapiens)
IP(Homo sapiens)
Western blot analysis of extracts of various cell lines, using ISG15 Rabbit mAb (A2416) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts from wild type(WT) and ISG15 Rabbit mAb knockdown (KD) Hela(KD) cells, using ISG15 Rabbit mAb antibody (A2416) at 1:510 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Confocal imaging of U-2 OS cells using [KD Validated] ISG15 Rabbit mAb (A2416, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1). Isotype IgG