быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADRA1A Rabbit mAb (A9410)
- Описание
- Характеристики
-
Overview
Product name ADRA1A Rabbit mAb Catalog No. A9410 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2740 Background
Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1A-adrenergic receptor. Alternative splicing of this gene generates four transcript variants, which encode four different isoforms with distinct C-termini but having similar ligand binding properties.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ADRA1A (P35348). Sequence VWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMAS Gene ID Swiss Prot Synonyms ADRA1C; ADRA1L1; ALPHA1AAR Calculated MW 51kDa Observed MW 58kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, U-87MG, Mouse lung Cellular location Cell membrane, Multi-pass membrane protein, Nucleus membrane 
Western blot analysis of extracts of various cell lines, using (A9410) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ADRA1A (P35348). Isotype IgG