быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
WDR5 Rabbit mAb (A3259)
- Описание
- Характеристики
-
Overview
Product name WDR5 Rabbit mAb Catalog No. A3259 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0769 Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1). Sequence DNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC Gene ID Swiss Prot Synonyms BIG3; SWD3; BIG-3; CFAP89 Calculated MW 37kDa Observed MW 37kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A549, HT-1080, Rat testis Cellular location Nucleus Customer validation (minami-45、PC-3、Ramos)
CHIP(Homo sapiens)
Western blot analysis of extracts of various cell lines, using WDR5 Rabbit mAb (A3259) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1). Isotype IgG