быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
TPPP/p25 Rabbit mAb (A4637)
- Описание
- Характеристики
-
Overview
Product name TPPP/p25 Rabbit mAb Catalog No. A4637 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1129 Background
Enables several functions, including GTPase activity; magnesium ion binding activity; and protein homodimerization activity. Involved in several processes, including microtubule cytoskeleton organization; negative regulation of tubulin deacetylation; and positive regulation of protein polymerization. Located in several cellular components, including mitochondrion; mitotic spindle; and perinuclear region of cytoplasm. Colocalizes with microtubule and microtubule bundle.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TPPP/p25 (O94811). Sequence FSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESG Gene ID Swiss Prot Synonyms p24; p25; TPPP1; TPPP/p25; p25alpha Calculated MW 24kDa Observed MW 26kDa Applications
Reactivity Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse brain, Rat brain Cellular location Cytoplasm, Nucleus, cytoskeleton 
Western blot analysis of extracts of various cell lines, using TPPP/p25 Rabbit mAb (A4637) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat brain using TPPP/p25 Rabbit mAb (A4637) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using TPPP/p25 Rabbit mAb (A4637) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TPPP/p25 (O94811). Isotype IgG