быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
βII-Tubulin/β2-Tubulin Rabbit mAb (A4798)
- Описание
- Характеристики
-
Overview
Product name βII-Tubulin/β2-Tubulin Rabbit mAb Catalog No. A4798 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0227 Background
Microtubules, key participants in processes such as mitosis and intracellular transport, are composed of heterodimers of alpha- and beta-tubulins. The protein encoded by this gene is a beta-tubulin. Defects in this gene are associated with complex cortical dysplasia with other brain malformations-5. Two transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2015]Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 346-445 of human βII-Tubulin/β2-Tubulin (Q13885). Sequence PNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA Gene ID Swiss Prot Synonyms CDCBM5; TUBB; TUBB2 Calculated MW 50kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples C6, U-251MG, Mouse brain Cellular location Cytoplasm, cytoskeleton, Microtubule 
Western blot analysis of extracts of various cell lines, using βII-Tubulin/β2-Tubulin Rabbit mAb (A4798) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded rat brain using βII-Tubulin/β2-Tubulin Rabbit mAb (A4798) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using βII-Tubulin/β2-Tubulin Rabbit mAb (A4798) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using βII-Tubulin/β2-Tubulin Rabbit mAb (A4798) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 346-445 of human βII-Tubulin/β2-Tubulin (Q13885). Isotype IgG