быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
TrkA Rabbit mAb (A4147)
- Описание
- Характеристики
-
Overview
Product name TrkA Rabbit mAb Catalog No. A4147 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0906 Background
This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 697-796 of human TrkA (P04629). Sequence ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG Gene ID Swiss Prot Synonyms MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA Calculated MW 87kDa Observed MW 140kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain, Rat brain Cellular location Cell membrane, Early endosome membrane, Late endosome membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using TrkA Rabbit mAb (A4147) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 697-796 of human TrkA (P04629). Isotype IgG