быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
WIPI1 Rabbit mAb (A9600)
- Описание
- Характеристики
-
Overview
Product name WIPI1 Rabbit mAb Catalog No. A9600 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1652 Background
This gene encodes a WD40 repeat protein. Members of the WD40 repeat family are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WIPI1 (Q5MNZ9). Sequence MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYS Gene ID Swiss Prot Synonyms ATG18; ATG18A; WIPI49 Calculated MW 49kDa Observed MW 49kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples BxPC-3, U-87MG, Mouse brain, Mouse kidney, Rat lung, Rat kidney Cellular location Cytoplasm, Cytoplasmic vesicle, Endosome, Golgi apparatus, Peripheral membrane protein, Preautophagosomal structure membrane, clathrin-coated vesicle, cytoskeleton, trans-Golgi network 
Western blot analysis of extracts of various cell lines, using WIPI1 Rabbit mAb (A9600) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WIPI1 (Q5MNZ9). Isotype IgG