быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
TRPC1 Rabbit mAb (A4016)
- Описание
- Характеристики
-
Overview
Product name TRPC1 Rabbit mAb Catalog No. A4016 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0884 Background
The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol second messenger system and also by depletion of intracellular calcium stores. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (P48995). Sequence LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG Gene ID Swiss Prot Synonyms TRP1; HTRP-1 Calculated MW 88kDa/91kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, PC-3, U-251MG, Mouse brain, Rat brain Cellular location Membrane Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using TRPC1 Rabbit mAb (A4016) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (P48995). Isotype IgG