быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
U1A/SNRPA Rabbit mAb (A3686)
- Описание
- Характеристики
-
Overview
Product name U1A/SNRPA Rabbit mAb Catalog No. A3686 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0823 Background
The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U1A/SNRPA (P09012). Sequence MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT Gene ID Swiss Prot Synonyms U1A; Mud1; U1-A Calculated MW 31kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, U-937, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using U1A/SNRPA Rabbit mAb (A3686) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of U-2 OS cells using U1A/SNRPA Rabbit mAb (A3686) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U1A/SNRPA (P09012). Isotype IgG