быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Xanthine Oxidase (XDH) Rabbit mAb (A9022)
- Описание
- Характеристики
-
Overview
Product name Xanthine Oxidase (XDH) Rabbit mAb Catalog No. A9022 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1385 Background
Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). Sequence TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHG Gene ID Swiss Prot Synonyms XO; XOR; XAN1 Calculated MW 146kDa Observed MW 150kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HepG2, Rat lung Cellular location Cytoplasm, Peroxisome, Secreted 
Western blot analysis of extracts of various cell lines, using Xanthine Oxidase (XDH) Rabbit mAb (A9022) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry of paraffin-embedded human liver cancer using Xanthine Oxidase (XDH) Rabbit mAb (A9022) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse brain using Xanthine Oxidase (XDH) Rabbit mAb (A9022) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse kidney using Xanthine Oxidase (XDH) Rabbit mAb (A9022) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using Xanthine Oxidase (XDH) Rabbit mAb (A9022) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). Isotype IgG