быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABI2 Rabbit pAb (A14992)
- Описание
- Характеристики
-
Overview
Product name ABI2 Rabbit pAb Catalog No. A14992 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables several functions, including SH3 domain binding activity; identical protein binding activity; and ubiquitin protein ligase binding activity. Contributes to small GTPase binding activity. Involved in Rac protein signal transduction; positive regulation of cellular component organization; and zonula adherens assembly. Acts upstream of or within peptidyl-tyrosine phosphorylation. Located in several cellular components, including filopodium tip; lamellipodium; and nucleoplasm. Part of SCAR complex. Is active in adherens junction. Colocalizes with actin filament.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABI2 (NP_001269854.1). Sequence HKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRT Gene ID Swiss Prot Synonyms AIP1; ABI-2; ABI2B; AIP-1; AblBP3; argBP1; SSH3BP2; argBPIA; argBPIB Calculated MW 56kDa Observed MW 50kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-251MG, Mouse brain Cellular location Cell projection, Cytoplasm, cytoskeleton, filopodium, lamellipodium 
Western blot analysis of extracts of various cell lines, using ABI2 antibody (A14992) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABI2 (NP_001269854.1). Isotype IgG