быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADAM32 Rabbit pAb (A14977)
- Описание
- Характеристики
-
Overview
Product name ADAM32 Rabbit pAb Catalog No. A14977 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the disintegrin family of membrane-anchored proteins that play a role in diverse biological processes such as brain development, fertilization, tumor development and inflammation. This gene is predominantly expressed in the testis. The encoded protein undergoes proteolytic processing to generate a mature polypeptide comprised of an metalloprotease, disintegrin and epidermal growth factor-like domains. This gene is located in a cluster of other disintegrin and metallopeptidase family genes on chromosome 8. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 703-787 of human ADAM32 (NP_659441.3). Sequence ARKQLKKWFAKEEEFPSSESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDSTQTQSSSN Gene ID Swiss Prot Synonyms ADAM32 Calculated MW 88kDa Observed MW 88kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Mouse brain Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using ADAM32 antibody (A14977) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 703-787 of human ADAM32 (NP_659441.3). Isotype IgG