быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADAMTS7 Rabbit pAb (A17093)
- Описание
- Характеристики
-
Overview
Product name ADAMTS7 Rabbit pAb Catalog No. A17093 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family. Members of this family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs and may regulate vascular smooth muscle cell (VSMC) migration. Mutations in this gene may be associated with susceptibility to coronary artery disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1600-1686 of human ADAMTS7 (NP_055087.2). Sequence QTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR Gene ID Swiss Prot Synonyms ADAM-TS7; ADAMTS-7; ADAM-TS 7 Calculated MW 184kDa Observed MW 200kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y Cellular location cell surface, endoplasmic reticulum lumen, extracellular region Customer validation WB(Mus musculus)
IHC(Mus musculus)
Western blot analysis of extracts of SH-SY5Y cells, using ADAMTS7 antibody (A17093) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1600-1686 of human ADAMTS7 (NP_055087.2). Isotype IgG