быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADAM11 Rabbit pAb (A14249)
- Описание
- Характеристики
-
Overview
Product name ADAM11 Rabbit pAb Catalog No. A14249 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. This gene represents a candidate tumor suppressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-430 of human ADAM11 (NP_002381.2). Sequence METWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGG Gene ID Swiss Prot Synonyms MDC Calculated MW 83kDa Observed MW 83kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples U-87MG, Mouse brain Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using ADAM11 antibody (A14249) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Immunofluorescence analysis of C6 cells using ADAM11 antibody (A14249) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using ADAM11 antibody (A14249) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-430 of human ADAM11 (NP_002381.2). Isotype IgG