быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADGRD1 Rabbit pAb (A12629)
- Описание
- Характеристики
-
Overview
Product name ADGRD1 Rabbit pAb Catalog No. A12629 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The adhesion G-protein-coupled receptors (GPCRs), including GPR133, are membrane-bound proteins with long N termini containing multiple domains. GPCRs, or GPRs, contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins (summary by Bjarnadottir et al., 2004 [PubMed 15203201]).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 805-874 of human ADGRD1 (NP_942122.2). Sequence FHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV Gene ID Swiss Prot Synonyms PGR25; GPR133 Calculated MW 97kDa Observed MW 105kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-87MG, LO2, 293T, Mouse kidney, Mouse liver, Rat brain Cellular location Cell membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using ADGRD1 antibody (A12629) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 805-874 of human ADGRD1 (NP_942122.2). Isotype IgG