быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
14-3-3 alpha/beta Rabbit pAb (A1023)
- Описание
- Характеристики
-
Overview
Product name 14-3-3 alpha/beta Rabbit pAb Catalog No. A1023 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-246 of human 14-3-3 alpha/beta (NP_003395.1). Sequence AYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN Gene ID Swiss Prot Synonyms HS1; GW128; YWHAA; KCIP-1; HEL-S-1 Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:100
- IF/ICC 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples Mouse intestine, Mouse liver, Mouse kidney, HT-29, SW480, BT-474, HepG2 Cellular location Cytoplasm, Melanosome Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using 14-3-3 alpha/beta antibody (A1023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using 14-3-3 alpha/beta antibody (A1023) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human appendix using 14-3-3 alpha/beta antibody (A1023) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using 14-3-3 alpha/beta antibody (A1023) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using 14-3-3 alpha/beta antibody (A1023) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-246 of human 14-3-3 alpha/beta (NP_003395.1). Isotype IgG