быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZPBP Rabbit pAb (A17625)
- Описание
- Характеристики
-
Overview
Product name ZPBP Rabbit pAb Catalog No. A17625 Host species Rabbit Purification method Affinity purification Isotype IgG Background
ZPBP is one of several proteins that are thought to participate in secondary binding between acrosome-reacted sperm and the egg-specific extracellular matrix, the zona pellucida (McLeskey et al., 1998 [PubMed 9378618]).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human ZPBP (NP_008940.2). Sequence HLVRLPRAFRLTKDSVKIVGSTSFPVKAYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQITSTGSLVFQNFEESMSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYYQFTARYHAAPCNSIYNISFEKKLLQILSK Gene ID Swiss Prot Synonyms ZPBP1; SPGF66 Calculated MW 40kDa Observed MW 34kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse brain Cellular location acrosomal membrane, acrosomal vesicle, extracellular region, nucleus 
Western blot analysis of extracts of Mouse brain, using ZPBP antibody (A17625) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human placenta using ZPBP Rabbit pAb (A17625) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Rat ovary using ZPBP Rabbit pAb (A17625) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat testis using ZPBP antibody (A17625) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse testis using ZPBP antibody (A17625) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human ZPBP (NP_008940.2). Isotype IgG