быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF768 Rabbit pAb (A17771)
- Описание
- Характеристики
-
Overview
Product name ZNF768 Rabbit pAb Catalog No. A17771 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables RNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-270 of human ZNF768 (NP_078947.3). Sequence PGYESESSRYESQNTELKTQSPEFEAQSSKFQEGAEMLLNPEEKSPLNISVGVHPLDSFTQGFGEQPTGDLPIGPPFEMPTGALLSTPQFEMLQNPLGLTGALRGPGRRGGRARGGQGPRPNICGICGKSF Gene ID Swiss Prot Synonyms ZNF768 Calculated MW 60kDa Observed MW 60kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse liver Cellular location nucleus 
Western blot analysis of extracts of Mouse liver, using ZNF768 antibody (A17771) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-270 of human ZNF768 (NP_078947.3). Isotype IgG