быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADORA1 Rabbit pAb (A18525)
- Описание
- Характеристики
-
Overview
Product name ADORA1 Rabbit pAb Catalog No. A18525 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is an adenosine receptor that belongs to the G-protein coupled receptor 1 family. There are 3 types of adenosine receptors, each with a specific pattern of ligand binding and tissue distribution, and together they regulate a diverse set of physiologic functions. The type A1 receptors inhibit adenylyl cyclase, and play a role in the fertilization process. Animal studies also suggest a role for A1 receptors in kidney function and ethanol intoxication. Transcript variants with alternative splicing in the 5' UTR have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-326 of human ADORA1 (NP_000665.1). Sequence LHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD Gene ID Swiss Prot Synonyms RDC7 Calculated MW 37kDa Observed MW 37kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse heart Cellular location basolateral plasma membrane, calyx of Held, dendrite, dendritic spine, endoplasmic reticulum, plasma membrane, postsynaptic density, postsynaptic membrane, presynaptic active zone, presynaptic membrane, synapse, terminal bouton 
Western blot analysis of extracts of Mouse heart, using ADORA1 antibody (A18525) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Immunohistochemistry analysis of paraffin-embedded rat brain using ADORA1 Rabbit pAb (A18525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal using ADORA1 Rabbit pAb (A18525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-326 of human ADORA1 (NP_000665.1). Isotype IgG