α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	α-Smooth Muscle Actin (ACTA2) Rabbit pAb
Catalog No.	A1011
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human α-Smooth Muscle Actin (ACTA2) (NP_001135417.1).
Sequence	MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
Gene ID
Swiss Prot
Synonyms	ACTSA
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IF/ICC
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse heart
Cellular location	Cytoplasm, cytoskeleton
Customer validation	WB(Homo sapiens,Mus musculus, Rattus norvegicus, Mus musculus, Homo sapiens) IF(Mus musculus) IHC(Mus musculus) IF(Mus musculus) IHC(Rattus norvegicus, Mus musculus) IF(Rattus norvegicus) ELISA(Homo sapiens) WB(Homo sapiens)

Western blot analysis of Mouse heart, using α-Smooth Muscle Actin (ACTA2) antibody (A1011) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunofluorescence analysis of rat rectum cells using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of human smooth muscle cells using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse colon cells using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human α-Smooth Muscle Actin (ACTA2) (NP_001135417.1).
Isotype	IgG