быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZP2 Rabbit pAb (A10126)
- Описание
- Характеристики
-
Overview
Product name ZP2 Rabbit pAb Catalog No. A10126 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1). Sequence KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH Gene ID Swiss Prot Synonyms ZPA; Zp-2; OOMD6; OZEMA6 Calculated MW 82kDa Observed MW 68kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:4000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples SH-SY5Y, HL-60, SW620, Mouse liver, Rat ovary Cellular location Cell membrane, Secreted, Single-pass type I membrane protein, extracellular matrix, extracellular space Customer validation WB(Mus musculus)
IHC(Homo sapiens)
Western blot analysis of extracts of various cell lines, using ZP2 antibody (A10126) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of Human ovarian cancer cells using ZP2 Rabbit pAb (A10126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse ovary cells using ZP2 Rabbit pAb (A10126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat ovary cells using ZP2 Rabbit pAb (A10126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1). Isotype IgG