быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
14-3-3 sigma Rabbit pAb (A1026)
- Описание
- Характеристики
-
Overview
Product name 14-3-3 sigma Rabbit pAb Catalog No. A1026 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma (NP_006133.1). Sequence MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL Gene ID Swiss Prot Synonyms YWHAS Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, A-549, MCF7, A-431, Mouse lung, Mouse kidney, Rat lung Cellular location Cytoplasm, Nucleus, Secreted Customer validation IHC(Mus musculus)
Western blot analysis of extracts of various cell lines, using 14-3-3 sigma antibody (A1026) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using 14-3-3 sigma antibody (A1026) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded rat skin using 14-3-3 sigma Rabbit pAb (A1026) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human skin using 14-3-3 sigma Rabbit pAb (A1026) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse skin using 14-3-3 sigma Rabbit pAb (A1026) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma (NP_006133.1). Isotype IgG