быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
β-Catenin Rabbit pAb (A11512)
- Описание
- Характеристики
-
Overview
Product name β-Catenin Rabbit pAb Catalog No. A11512 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 667-781 of human β-Catenin (NP_001895.1). Sequence PQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL Gene ID Swiss Prot Synonyms EVR7; CTNNB; MRD19; NEDSDV; armadillo Calculated MW 85kDa Observed MW 92kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:20 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples Mouse brain, Mouse lung, C6 Cellular location Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole Customer validation WB(Adenocarcinoma human alveolar basal epithelial cells, rat cells, Rattus norvegicus, Homo sapiens, Mus musculus, Danio rerio, Capra hircus)
IF(Rattus norvegicus)
IHC(Homo sapiens,Rattus norvegicus)
Western blot analysis of various lysates, using β-Catenin Rabbit pAb (A11512) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg β-Catenin antibody (A11512). Western blot was performed from the immunoprecipitate using β-Catenin antibody (A11512) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 667-781 of human β-Catenin (NP_001895.1). Isotype IgG