быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADH1A/ADH1B/ADH1C Rabbit pAb (A18581)
- Описание
- Характеристики
-
Overview
Product name ADH1A/ADH1B/ADH1C Rabbit pAb Catalog No. A18581 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 280 to the C-terminus of human ADH1A/ADH1B/ADH1C (NP_000659.2). Sequence LLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF Gene ID Swiss Prot Synonyms ADH1A/ADH1B/ADH1C Calculated MW Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse lung Cellular location cytosol, nucleoplasm, plasma membrane 
Western blot analysis of extracts of Mouse lung, using ADH1A/ADH1B/ADH1C Rabbit pAb (A18581) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of Human liver using ADH1A/ADH1B/ADH1C Rabbit pAb (A18581) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of Rat liver using ADH1A/ADH1B/ADH1C Rabbit pAb (A18581) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of Mouse liver using ADH1A/ADH1B/ADH1C Rabbit pAb (A18581) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 280 to the C-terminus of human ADH1A/ADH1B/ADH1C (NP_000659.2). Isotype IgG