быстрая доставка ~4 недели
Размер
- 100 μL
- 50 μL
β-Catenin Rabbit pAb (A11932)
- Описание
- Характеристики
-
Overview
Product name β-Catenin Rabbit pAb Catalog No. A11932 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (NP_001895.1). Sequence MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP Gene ID Swiss Prot Synonyms EVR7; CTNNB; MRD19; NEDSDV; armadillo Calculated MW 85kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse brain, Rat brain Cellular location Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole Customer validation IHC(Mouse colon)
IF(Mouse colon, Mus musculus, Homo sapiens)
WB(Mus musculus, Rattus norvegicus)
IHC(Mus musculus)
Western blot analysis of extracts of various cell lines, using β-Catenin antibody (A11932) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of U2OS cells using β-Catenin antibody (A11932) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (NP_001895.1). Isotype IgG