быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADAM23 Rabbit pAb (A14263)
- Описание
- Характеристики
-
Overview
Product name ADAM23 Rabbit pAb Catalog No. A14263 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. It is reported that inactivation of this gene is associated with tumorigenesis in human cancers.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human ADAM23 (NP_003803.1). Sequence VETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLF Gene ID Swiss Prot Synonyms MDC3; MDC-3 Calculated MW 92kDa Observed MW 92kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Raji, Mouse heart Cellular location Cell membrane, Secreted, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using ADAM23 antibody (A14263) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human ADAM23 (NP_003803.1). Isotype IgG