быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ABCG4 Rabbit pAb (A14596)
- Описание
- Характеристики
-
Overview
Product name ABCG4 Rabbit pAb Catalog No. A14596 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein is a member of the White subfamily and plays an important role in cellular cholesterol homeostasis. This protein functions as either a homodimer or as a heterodimer with another ABC subfamily protein such as ABCG1.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human ABCG4 (NP_071452.2). Sequence KLYILSQGQCIFKGVVTNLIPYLKGLGLHCPTYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATST Gene ID Swiss Prot Synonyms WHITE2 Calculated MW 72kDa Observed MW 72kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-87MG, A-549, U-937, Mouse brain, Rat brain Cellular location Membrane, Multi-pass membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using ABCG4 antibody (A14596) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human ABCG4 (NP_071452.2). Isotype IgG