быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACBD3 Rabbit pAb (A16568)
- Описание
- Характеристики
-
Overview
Product name ACBD3 Rabbit pAb Catalog No. A16568 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ACBD3 (NP_073572.2). Sequence MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVE Gene ID Swiss Prot Synonyms PAP7; GCP60; GOCAP1; GOLPH1 Calculated MW 61kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, HepG2, Mouse testis, Rat testis Cellular location Cytoplasmic side, Golgi apparatus membrane, Mitochondrion, Peripheral membrane protein 
Western blot analysis of extracts of various cell lines, using ACBD3 Rabbit pAb (A16568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of C6 cells using ACBD3 antibody (A16568) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using ACBD3 antibody (A16568) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ACBD3 (NP_073572.2). Isotype IgG