быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ABCG1 Rabbit pAb (A4328)
- Описание
- Характеристики
-
Overview
Product name ABCG1 Rabbit pAb Catalog No. A4328 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 6-120 of human ABCG1 (NP_004906.3). Sequence AAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPS Gene ID Swiss Prot Synonyms ABC8; WHITE1 Calculated MW 76kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HUVEC, A-549, RAW264.7 Cellular location Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein Customer validation WB(Homo sapiens, Mus musculus, Rattus norvegicus)
Western blot analysis of various lysates, using ABCG1 Rabbit pAb (A4328) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ABCG1 Rabbit pAb (A4328) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of Rat lung using ABCG1 antibody (A4328) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 6-120 of human ABCG1 (NP_004906.3). Isotype IgG