быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACVR1B Rabbit pAb (A5453)
- Описание
- Характеристики
-
Overview
Product name ACVR1B Rabbit pAb Catalog No. A5453 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes an activin A type IB receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I and two type II receptors. This protein is a type I receptor which is essential for signaling. Mutations in this gene are associated with pituitary tumors. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-126 of human ACVR1B (NP_004293.1). Sequence SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE Gene ID Swiss Prot Synonyms ALK4; SKR2; ACTRIB; ACVRLK4 Calculated MW 57kDa Observed MW 49kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples SW480, Mouse kidney Cellular location Cell membrane, Single-pass type I membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using ACVR1B antibody (A5453) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-126 of human ACVR1B (NP_004293.1). Isotype IgG