быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADAM5 Rabbit pAb (A6196)
- Описание
- Характеристики
-
Overview
Product name ADAM5 Rabbit pAb Catalog No. A6196 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to be involved in binding activity of sperm to zona pellucida and cell adhesion.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ADAM5 (Q6NVV9). Sequence NCGTAHCLFQHILCGKLVCTWEHRDLISRPNLSVIYAHVRDQTCVSTYLPRRTPPPVNSPISITSYYSAEDRDETFVQDGSMCGPDMYCFEMHCKHVRFLM Gene ID Swiss Prot Synonyms ADAM5P; TMDCII Calculated MW 47kDa Observed MW 50kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse testis, Mouse ovary Cellular location 
Western blot analysis of various lysates, using ADAM5 antibody (A6196) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ADAM5 (Q6NVV9). Isotype IgG